Thymosins & Host-Defence Peptides — 20% off

Select items at 20% off list price while the sale runs. Quantity pricing at 5+ and 10+ vials also applies. Same lots, same Certificates of Analysis.

0 products · HPLC-tested lots · Certificate of Analysis for every lot · laboratory research use only

No products match. Clear filters

Compounds in Thymosins & Host-Defence Peptides

Specifications and the current-lot Certificate of Analysis are on each product page.

375: 37-residue cationic α-helical peptide, [LL-37, 37 aa]
BT: Synthetic peptide; composition as stated on the lot's Certificate of Analysis.
TA: 28-amino-acid N-terminally acetylated peptide, Ac-SDAAVDTSSEITTKDLKEKKEVVEEAEN.