★ SALE20% OFFSHOP NOW ★
≥99% purity · COA on every lot · Free shipping over $300 · Laboratory research use only

Thymosins & Host-Defence Peptides

3 products · HPLC-tested lots · Certificate of Analysis for every lot · laboratory research use only

Compounds in Thymosins & Host-Defence Peptides

Specifications and the current-lot Certificate of Analysis are on each product page.

375
37-residue cationic α-helical peptide, [LL-37, 37 aa]
BT
Synthetic peptide; composition as stated on the lot's Certificate of Analysis.
TA
28-amino-acid N-terminally acetylated peptide, Ac-SDAAVDTSSEITTKDLKEKKEVVEEAEN.

Thymosins & Host-Defence Peptides: frequently asked questions

How are Thymosins & Host-Defence Peptides products tested?

Each lot is documented with a Certificate of Analysis reporting HPLC purity, plus endotoxin and heavy-metals results where listed. The current lot's certificate is linked on each product page once published, and past certificates are archived in the COA library.

How we test and document every lot